PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010523904.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family MYB_related
Protein Properties Length: 459aa    MW: 51807.1 Da    PI: 9.7218
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010523904.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding254.5e-08132173345
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                       WT+eE ++l d+++++  + +  Ia ++++ Rt +++k+r++
   XP_010523904.1 132 VWTKEETDQLFDLCERFDLR-FIVIADRFPLSRTVEELKDRYY 173
                      6*******************.*********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF162823.5E-29105174IPR032563DAMP1, SANT/Myb-like domain
SuperFamilySSF466897.58E-6129174IPR009057Homeodomain-like
SMARTSM007171.3E-4129178IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-5132174IPR009057Homeodomain-like
CDDcd116587.89E-19133174No hitNo description
PfamPF054991.5E-7336400IPR008468DNA methyltransferase 1-associated 1
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0000812Cellular ComponentSwr1 complex
GO:0035267Cellular ComponentNuA4 histone acetyltransferase complex
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 459 aa     Download sequence    Send to blast
MGGTDAKDIL GLPKTPLSIT QEKKPRPQKE SHRKPDGISR EVYALTGGIP PLMPSIDVSQ  60
LKRRPPADEK VVWRWLPFTN SARKDNLQLY HWVRVVNDVP PTGDYSFAKY NKSVDIMKYT  120
DEEYEKYLTD PVWTKEETDQ LFDLCERFDL RFIVIADRFP LSRTVEELKD RYYSGSGIRL  180
IMAVLSFVVT RALLRVRAQS PADVANHPLI KEQYDITRDR DRKRALSVVL SQTRQQEKKD  240
TEILAEAKRI TEARLAAWST EEPDVPVNAT AGPEKADGVV VPGDSVSPSA NVPPPTSGAA  300
PSTLVMPDNA STIASLRMLR VYLRTYALEQ MVQAASSSVG LRTIKRVEQT LQDLGVNLKP  360
KVPTKTVCDE HLELRKEILT LLNLQKQLQY KEAEGSSYRE GSYAEMPEPP QDRVFAQEPF  420
SFGAERPTKK DQKRKGPGRQ ANTPSPAHKR PRKMKASDL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3hm5_A5e-20104174478DNA methyltransferase 1-associated protein 1
4iej_A5e-20104174478DNA methyltransferase 1-associated protein 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010523904.10.0PREDICTED: DNA methyltransferase 1-associated protein 1 isoform X1
SwissprotQ8VZL60.0SWC4_ARATH; SWR1-complex protein 4
TrEMBLD7LG020.0D7LG02_ARALL; Myb family transcription factor
STRINGscaffold_403698.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM85432435
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47210.10.0MYB_related family protein